Recombinant Human Monocyte differentiation antigen CD14 (CD14), partial (Active)
This Recombinant Human Monocyte differentiation antigen CD14 (CD14), partial (Active) spans the amino acid sequence from region 20-344aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Monocyte differentiation antigen CD14; My23 antigen; Myeloid cell-specific leucine-rich glycoprotein; CD14
UniProt
P08571
Expression Region
20-344aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation; Stem Cell & Developmental Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD14 at 2 μg/mL on an Nickel Coated plate can bind Anti-CD14 recombinant antibody. The EC50 is 2.148-2.447 ng/mL.
Form
Lyophilized powder
Molecular Weight
37.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
128072-ML405 100 µL
HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1) (MaxLight 405) discontinued
Sign In for Pricing
View Details TRV-0025144 96 Tests
Multiplex Assay Kit for Fibroblast Growth Factor 4 (FGF4), etc. by FLIA (Flow Luminescence Immunoassay)
Sign In for Pricing
View Details 
R2033-11M2-ML750 100 µL
RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1, MSSP1) (MaxLight 750) discontinued
Sign In for Pricing
View Details GTR15271506 1 Vial
Lentiviral mouse Sphk1 shRNA (UAS) - Lentiviral mouse Sphk1 shRNA (UAS) (100)
Sign In for Pricing
View Details MBS6285135-01 0.1 mL
CENPN, CT (CENPN, C16orf60, ICEN32, Centromere protein N, Interphase centromere complex protein 32) (MaxLight 550)
Sign In for Pricing
View Details