Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial (Active)

This Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial (Active) spans the amino acid sequence from region 28-480aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Intercellular adhesion molecule 1; ICAM-1; Major group rhinovirus receptor; CD54; ICAM1

UniProt

P05362

Expression Region

28-480aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ICAM1 at 2 μg/mL can bind Anti-ICAM1 recombinant antibody. The EC50 is 0.2350-0.4911 ng/mL.

Form

Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMN-BRANDBLUSKOOLZU.-RD3-RLL090 Pipe Markers for Fire Systems
267796 505 Roll (505 Marker (s) x 1 Roll)

PMN-BRANDBLUSKOOLZU.-RD3-RLL090 Pipe Markers for Fire Systems

Sign In for Pricing
View Details
ZNF239 antibody - N-terminal region (ARP37749_P050)
ARP37749_P050 100 µL

ZNF239 antibody - N-terminal region (ARP37749_P050)

Sign In for Pricing
View Details
OR13D2P-set siRNA/shRNA/RNAi Lentivector (Human)
34963091 4x 500 ng

OR13D2P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ZNF429 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2705606 1.0 µg DNA

ZNF429 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Abca8a Protein Vector (Mouse) (pPB-C-His)
PV151058 500 ng

Abca8a Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Cnnm2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6487407 1.0 µg DNA

Cnnm2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details