Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica 13 kDa prolamin C (PROLM25)

Product Specifications

Abbreviation

Recombinant Oryza sativa subsp. japonica PROLM25 protein

Gene Name

PROLM25

UniProt

P17048

Expression Region

20-156aa

Organism

Oryza sativa subsp. japonica (Rice)

Target Sequence

RFDPLSQSYRQYQLQSHLLLQQQVLSPCSEFVRQQYSIVATPFWQPATFQLINNQVMQQQCCQQLRLVAQQSHYQAISIVQAIVQQLQLQQFSGVYFDQTQAQAQTLLTFNLPSICGIYPNYYSAPRSIATVGGVWY

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Seed storage protein; serves as a source of nitrogen, carbon and sulfur for the young developing seedling.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.9 kDa

References & Citations

"Cloning and characterization of a cDNA encoding a rice 13 kDa prolamin." Masumura T., Hibino T., Kidzu K., Mitsukawa N., Tanaka K., Fujii S. Mol. Gen. Genet. 221:1-7 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensinogen Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61143R-APC-Cy5.5 100 µL

Angiotensinogen Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Brilliant Violet 650™ anti-human CD45
GT07897 100 Tests

Brilliant Violet 650™ anti-human CD45

Sign In for Pricing
View Details
Baloxavir Impurity 21 (S199BE)
RM-B011521-01 10 mg

Baloxavir Impurity 21 (S199BE)

Sign In for Pricing
View Details
Baloxavir Impurity 21 (S199BE)
RM-B011521-02 25 mg

Baloxavir Impurity 21 (S199BE)

Sign In for Pricing
View Details
Baloxavir Impurity 21 (S199BE)
RM-B011521-03 50 mg

Baloxavir Impurity 21 (S199BE)

Sign In for Pricing
View Details
Baloxavir Impurity 21 (S199BE)
RM-B011521-04 100 mg

Baloxavir Impurity 21 (S199BE)

Sign In for Pricing
View Details