Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-1-pentanol
TRC-A618965-250MG 250 mg

4-Amino-1-pentanol

Sign In for Pricing
View Details
Tissue Embedding System BHTP-601
BHTP-601 1 Unit

Tissue Embedding System BHTP-601

Sign In for Pricing
View Details
CACNA2D1 Human Gene Knockout Kit (CRISPR)
KN419081 1 Kit

CACNA2D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LAMB3 Rabbit Polyclonal Antibody
HA500480 100 µL

LAMB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prrg1 Mouse Gene Knockout Kit (CRISPR)
KN514010 1 Kit

Prrg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (KP1), CF405M conjugate, 0.1mg/mL
BNC050512-100 1x 100 µL

CD68 (KP1), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details