Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF405S conjugate, 0.1mg/mL
BNC041826-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pirquinozol
TRC-P511000-2.5MG 2.5 mg

Pirquinozol

Sign In for Pricing
View Details
1,2-Benzisoxazol-3-ylacetic Acid
TRC-B201960-5G 5 g

1,2-Benzisoxazol-3-ylacetic Acid

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Succinamic Boc Hydrazido PEG
135000-00-37.1G 1 g

Ɑ-Hydroxy-ω-Succinamic Boc Hydrazido PEG

Sign In for Pricing
View Details
D-Glucono-1,4-lactone
TRC-G417478-25MG 25 mg

D-Glucono-1,4-lactone

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF594 conjugate, 0.1mg/mL
BNC941388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details