Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF740 conjugate, 0.1mg/mL
BNC743813-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APPBP1 (NAE1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E10]
TA804384BM 100 µL

APPBP1 (NAE1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E10]

Sign In for Pricing
View Details
Sumo 1 (SUMO1) Mouse Monoclonal Antibody [Clone ID: 66AT1273.94]
AM11043PU-N 400 µL

Sumo 1 (SUMO1) Mouse Monoclonal Antibody [Clone ID: 66AT1273.94]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803487 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
SCG2 Polyclonal Antibody
E-AB-61953-01 60 µL

SCG2 Polyclonal Antibody

Sign In for Pricing
View Details
SCG2 Polyclonal Antibody
E-AB-61953-02 120 µL

SCG2 Polyclonal Antibody

Sign In for Pricing
View Details