Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2), Biotinylated

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camostat mesylate
SIH-585-50MG 50 mg

Camostat mesylate

Sign In for Pricing
View Details
TJP2 (NM_004817) Human Recombinant Protein
TP305295L 1 mg

TJP2 (NM_004817) Human Recombinant Protein

Sign In for Pricing
View Details
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]
CF810154 100 µg

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

Sign In for Pricing
View Details
Mouse Complement C3, C-His Tag
HA211093-01 Inquire

Mouse Complement C3, C-His Tag

Sign In for Pricing
View Details
Mouse Complement C3, C-His Tag
HA211093-02 100 µg

Mouse Complement C3, C-His Tag

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF488A conjugate, 0.1mg/mL
BNC880762-100 1x 100 µL

IgM Immunoglobulin (Cocktail), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details