Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2), Biotinylated

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100365970 3'UTR GFP Stable Cell Line
TU259708 1.0 mL

LOC100365970 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RGD1306625 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38976156 3x 1.0 µg DNA

RGD1306625 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Mouse DHX30 Protein, His (Fc)-Avi-tagged
DHX30-2364M 50 µg

Recombinant Mouse DHX30 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
AATK (Serine/Threonine-Protein Kinase LMTK1, Apoptosis-Associated Tyrosine Kinase, AATYK, Brain Apoptosis-Associated Tyrosine Kinase, CDK5-Binding Protein, Lemur Tyrosine Kinase 1, p35-Binding Protein, p35BP, AATK, AATYK, KIAA0641, LMR1, LMTK1) (FITC) discontinued
302228-FITC 200 µL

AATK (Serine/Threonine-Protein Kinase LMTK1, Apoptosis-Associated Tyrosine Kinase, AATYK, Brain Apoptosis-Associated Tyrosine Kinase, CDK5-Binding Protein, Lemur Tyrosine Kinase 1, p35-Binding Protein, p35BP, AATK, AATYK, KIAA0641, LMR1, LMTK1) (FITC) discontinued

Sign In for Pricing
View Details
Biotinylated Recombinant Human PDGFR-beta/CD140b Protein
RP02478B-01 100 μg

Biotinylated Recombinant Human PDGFR-beta/CD140b Protein

Sign In for Pricing
View Details
Biotinylated Recombinant Human PDGFR-beta/CD140b Protein
RP02478B-02 500 μg

Biotinylated Recombinant Human PDGFR-beta/CD140b Protein

Sign In for Pricing
View Details