Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5), Biotinylated

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menisdaurin
BUP22255 1 mg

Menisdaurin

Sign In for Pricing
View Details
ACP-5862
MBS5765995 Inquire

ACP-5862

Sign In for Pricing
View Details
SP17 (SPA17) Human shRNA Plasmid Kit (Locus ID 53340)
TR317210 1 Kit

SP17 (SPA17) Human shRNA Plasmid Kit (Locus ID 53340)

Sign In for Pricing
View Details
P11L1w Plasmid
PVT65447 2 µg

P11L1w Plasmid

Sign In for Pricing
View Details
Human Kinesin 2 (KNS2) ELISA Kit
DLR-KNS2-Hu-48T 48 Tests

Human Kinesin 2 (KNS2) ELISA Kit

Sign In for Pricing
View Details
KBTBD11 Rabbit pAb, IRDye 800CW conjugated
orb2862852 100 µL

KBTBD11 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details