Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated

This Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-HO-EHDPP
TRC-H456430-2.5MG 2.5 mg

5-HO-EHDPP

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A6]
TA502924AM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A6]

Sign In for Pricing
View Details
CD55 (NM_001114752) Human Over-expression Lysate
LC426508 20 µg

CD55 (NM_001114752) Human Over-expression Lysate

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]
TA801268BM 100 µL

ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]

Sign In for Pricing
View Details
ATG5 Human Knockdown Lysate
LY300059 100 µg

ATG5 Human Knockdown Lysate

Sign In for Pricing
View Details
Colistin B Sulfate Salt (~90%)
TRC-C641515-5MG 5 mg

Colistin B Sulfate Salt (~90%)

Sign In for Pricing
View Details