Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated

This Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biocytin
TRC-B388100-10MG 10 mg

Biocytin

Sign In for Pricing
View Details
Human CD137 Recombinant Rabbit Monoclonal Antibody [PSH08-64] - BSA and Azide free (Detector)
HA723013 100 µL

Human CD137 Recombinant Rabbit Monoclonal Antibody [PSH08-64] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-36b/IL-36b Protein
PKSM041093-01 10 µg

Recombinant Mouse Interleukin-36b/IL-36b Protein

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-36b/IL-36b Protein
PKSM041093-02 50 µg

Recombinant Mouse Interleukin-36b/IL-36b Protein

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2553), CF740 conjugate, 0.1mg/mL
BNC742553-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2553), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP3R2 (NM_147180) Human Recombinant Protein
TP305406M 100 µg

PPP3R2 (NM_147180) Human Recombinant Protein

Sign In for Pricing
View Details