Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated

This Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Transthyretin discontinued
298976 100 µL

Transthyretin discontinued

Sign In for Pricing
View Details
Mouse Mitochondrial import receptor subunit TOM7 homolog (TOMM7) ELISA kit
GTR10386543 96 Well

Mouse Mitochondrial import receptor subunit TOM7 homolog (TOMM7) ELISA kit

Sign In for Pricing
View Details
CDX1, CT (CDX1, Homeobox protein CDX-1, Caudal-type homeobox protein 1) (APC) discontinued
033732-APC 200 µL

CDX1, CT (CDX1, Homeobox protein CDX-1, Caudal-type homeobox protein 1) (APC) discontinued

Sign In for Pricing
View Details