Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARS2 Polyclonal Antibody
E-AB-62471-01 60 µL

DARS2 Polyclonal Antibody

Sign In for Pricing
View Details
DARS2 Polyclonal Antibody
E-AB-62471-02 120 µL

DARS2 Polyclonal Antibody

Sign In for Pricing
View Details
DARS2 Polyclonal Antibody
E-AB-62471-03 200 µL

DARS2 Polyclonal Antibody

Sign In for Pricing
View Details
UCN-02
T17198-01 1 mg

UCN-02

Sign In for Pricing
View Details
UCN-02
T17198-02 5 mg

UCN-02

Sign In for Pricing
View Details
Mcpt2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV686316 1.0 µg DNA

Mcpt2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details