Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF10B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2415608 1.0 µg DNA

TNFRSF10B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Park7 (Protein DJ-1, DJ-1, Contraception-Associated Protein 1)
397505 100 µg

Park7 (Protein DJ-1, DJ-1, Contraception-Associated Protein 1)

Sign In for Pricing
View Details
CCRL1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
15435154 3x 1.0 µg DNA

CCRL1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
DR1 (C-8) : m-IgGκ BP-HRP Bundle
sc-536401 1 Kit

DR1 (C-8) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
HCFC1 Recombinant Protein
OPCD00539-10UG 10 µg

HCFC1 Recombinant Protein

Sign In for Pricing
View Details
Hoxb6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3884905 3x 1.0 µg

Hoxb6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details