Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated

This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3

UniProt

P0DPQ6

Expression Region

1-34

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF640R conjugate, 0.1mg/mL
BNC403807-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIN4 (NM_006223) Human Over-expression Lysate
LY401874 100 µg

PIN4 (NM_006223) Human Over-expression Lysate

Sign In for Pricing
View Details
EEF2K (NM_013302) Human Recombinant Protein
TP307496L 1 mg

EEF2K (NM_013302) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Mouse IFN Alpha (TIF-3C5) In Vivo Antibody - Low Endotoxin
ICH1135-5mg 5 mg

Anti-Mouse IFN Alpha (TIF-3C5) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Patched Antibody
8C0296-AAT 50 µg

Patched Antibody

Sign In for Pricing
View Details
Hexyl b-D-Thioglucopyranoside
TRC-H298000-500MG 500 mg

Hexyl b-D-Thioglucopyranoside

Sign In for Pricing
View Details