Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated

This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3

UniProt

P0DPQ6

Expression Region

1-34

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACK1/TNK2 Protein (GST Tag)
PKSH030470 50 µg

Recombinant Human ACK1/TNK2 Protein (GST Tag)

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C1]
TA506747AM 100 µL

CD44 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C1]

Sign In for Pricing
View Details
Homosalate
TRC-H614000-5G 5 g

Homosalate

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (E29), 0.2mg/mL
BNUB0478-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (E29), 0.2mg/mL

Sign In for Pricing
View Details
o-Iodochlorobenzene
TRC-I694400-25G 25 g

o-Iodochlorobenzene

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL
BNC472302-500 1x 500 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details