Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP), Biotinylated

This Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP), Biotinylated spans the amino acid sequence from region 1-734. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Casein kinase II subunit alpha'-interacting protein; Casein kinase 2 alpha prime interacting protein; CSNK2A2IP CSNKA2IP

UniProt

A0A1B0GTH6

Expression Region

1-734

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPLAYYGQHFVPLDYFYQLSSANTLTHQHTGEKLNQFNNQPMAKVQSHSNHFAVPPLGSNKKVQRCSVLPSPKSQDKISQSFCDRFLNSPLFHAKHQNTPSIGLHWRSSLWPAQRALNSHLLHSKAQTTSSSDLNMTSSLELNQAALSLQLPFCKPQTTSSSLDVCWRSLSLKSHQRVSSSSLFRLQNQEIPSINIIWTSSSLGPKRKALSSTLLQSKPQKTSSLDYLWTSSLQRNQRSLSSPSLNTKLQTSDLFWTSPSFKPNQIALTSPLLDSRLQKTPILNSNPTIGGLPVSHSKARQSASSYFVHPSENLPLFQLNSQSMFMLDCNFQTTNSPVCHSKFQNTTSPNGKHRVTHLPSPHPKTNISGQLLSSSKHCTRNTAASTLGFRLQSKSSFQFSPKTESNKEIPWTLKYSQPCIVKGGTVPDDVVNKIVNSISNTRIQRDLCRQILFRRMRGRPNPHPGPRLSSNYVVCLACASCLKSPCNHLRGKKNPHCATLSVIPTPEANSEGKIEVKLVLILSLPETFSSCLPFPMKENQPNEVPEDNLEGVEKIQQFFPTSERDIQGLNMKQIWWAVAPENKVIGQQPQAIDWLFYVKKNNSQPQSLLPSTSSSTSSSSTTSSSSSVASASSDSSSSSSSSSSFSISSSSSPSKEFMTLTLSRPVFRKVLSYHRLPAGVSWLEFIYSKDYQLHPRKPNRSQSSSLKTKPVRNNNTVKWRKGANTLFKFFRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MitoLite™ NIR FX690
22690-AAT 500 Tests

MitoLite™ NIR FX690

Sign In for Pricing
View Details
FBXW7 Human Gene Knockout Kit (CRISPR)
KN417398 1 Kit

FBXW7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H2B (Ab-5) Antibody
8D0023-AAT 50 µg

Histone H2B (Ab-5) Antibody

Sign In for Pricing
View Details
c-Myc (MYC) pSer373 Rabbit Polyclonal Antibody
AP02337PU-S 50 µL

c-Myc (MYC) pSer373 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBP1 (122-135) Goat Polyclonal Antibody
AP22572PU-N 50 µg

RBP1 (122-135) Goat Polyclonal Antibody

Sign In for Pricing
View Details
HEF1 (NEDD9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E3]
TA809512AM 100 µL

HEF1 (NEDD9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E3]

Sign In for Pricing
View Details