Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E13 (SPD13), Biotinylated

This Recombinant Human Speedy protein E13 (SPD13), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E13 SPDYE13

UniProt

A0A494C0Z2

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OATA00171-500UG - Mouse Ly-6G Antibody : Biotin
OATA00171-500UG 500 µg

OATA00171-500UG - Mouse Ly-6G Antibody : Biotin

Sign In for Pricing
View Details
Mouse JAM-C HEK293 Overexpression Lysate
MBS8116626-01 0.3 mg

Mouse JAM-C HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse JAM-C HEK293 Overexpression Lysate
MBS8116626-02 5x 0.3 mg

Mouse JAM-C HEK293 Overexpression Lysate

Sign In for Pricing
View Details
GMEB2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0872802 1.0 µg DNA

GMEB2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Adiponectin receptor protein 2 (ADIPOR2), partial
MBS7090785-01 0.05 mg (E-Coli)

Recombinant Human Adiponectin receptor protein 2 (ADIPOR2), partial

Sign In for Pricing
View Details
Recombinant Human Adiponectin receptor protein 2 (ADIPOR2), partial
MBS7090785-02 0.05 mg (Yeast)

Recombinant Human Adiponectin receptor protein 2 (ADIPOR2), partial

Sign In for Pricing
View Details