Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E13 (SPD13), Biotinylated

This Recombinant Human Speedy protein E13 (SPD13), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E13 SPDYE13

UniProt

A0A494C0Z2

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM17A sgRNA CRISPR Lentivector (Human) (Target 3)
K2375204 1.0 µg DNA

TIMM17A sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Assay buffer
3652-J2 2x 120 mL

Assay buffer

Sign In for Pricing
View Details
MRPL17 Blocking Peptide
abx162291-01 1 mg

MRPL17 Blocking Peptide

Sign In for Pricing
View Details
MRPL17 Blocking Peptide
abx162291-02 5 mg

MRPL17 Blocking Peptide

Sign In for Pricing
View Details
Ralb (NM_022327) Mouse Recombinant Protein
TP502182 20 µg

Ralb (NM_022327) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mouse Adrenomedullin (ADM) ELISA Kit
orb1807770-01 48 Tests

Mouse Adrenomedullin (ADM) ELISA Kit

Sign In for Pricing
View Details