Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein ATXN8OS (AT8OS), Biotinylated

This Recombinant Human Putative protein ATXN8OS (AT8OS), Biotinylated spans the amino acid sequence from region 1-200. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein ATXN8OS; ATXN8 opposite strand; Spinocerebellar ataxia 8; kelch-like 1 antisense; ATXN8OS KLHL1AS SCA8

UniProt

P0DMR3

Expression Region

1-200

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPCPGAPCCSLVATGSRVPFSGLKEEEEEDGEDDEEEEEEGFFQKVLTPLLSWLLSRRLWLGPQCSKLPLPSCCRQPPPAGPPVEGDGWLKSFQRSRRMCFTSKSFRPEPDMLYAQKAKGWQLTQDSGGWEVQDQCTRIWSKENLLALNTHSRRQKGKRENKVCVSTWQKSRGDRTYSSMATTPSMTKILEGCMYRKLKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella Multocida ompH Protein (aa 21-343)
VAng-Cr7032-50gEcoli 50 µg (E. coli)

Recombinant Pasteurella Multocida ompH Protein (aa 21-343)

Sign In for Pricing
View Details
DFNB44 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV722834 1.0 µg DNA

DFNB44 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral human DNAH10 sgRNA gene knockout kit - Lentiviral human DNAH10 sgRNA gene knockout kit (plasmid)
GTR15364073 1 Vial

Lentiviral human DNAH10 sgRNA gene knockout kit - Lentiviral human DNAH10 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Mouse TPP1 Baculovirus-Insect Overexpression Lysate
MBS8117147-01 0.3 mg

Mouse TPP1 Baculovirus-Insect Overexpression Lysate

Sign In for Pricing
View Details
Mouse TPP1 Baculovirus-Insect Overexpression Lysate
MBS8117147-02 5x 0.3 mg

Mouse TPP1 Baculovirus-Insect Overexpression Lysate

Sign In for Pricing
View Details
PLSCR4 Lentiviral Activation Particles (m2)
sc-433468-LAC-2 200 µL

PLSCR4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details