Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial

This Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial spans the amino acid sequence from region 35-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neural cell adhesion molecule L1-like protein; Close homolog of L1; [Cleaved into: Processed neural cell adhesion molecule L1-like protein] CHL1 CALL

UniProt

O00533

Expression Region

35-124

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSN2 Rabbit pAb
E45R19368N-100 100 µL

CSN2 Rabbit pAb

Sign In for Pricing
View Details
C17orf82 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-9649R-PE-Cy5.5 100 µL

C17orf82 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
P210L Polyclonal Antibody
BT-AP12604-01 20 µL

P210L Polyclonal Antibody

Sign In for Pricing
View Details
P210L Polyclonal Antibody
BT-AP12604-02 50 µL

P210L Polyclonal Antibody

Sign In for Pricing
View Details
P210L Polyclonal Antibody
BT-AP12604-03 100 µL

P210L Polyclonal Antibody

Sign In for Pricing
View Details
MAN1A2 Antibody (Center)
E45R08299G-1 100 µL

MAN1A2 Antibody (Center)

Sign In for Pricing
View Details