Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial

This Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial spans the amino acid sequence from region 35-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neural cell adhesion molecule L1-like protein; Close homolog of L1; [Cleaved into: Processed neural cell adhesion molecule L1-like protein] CHL1 CALL

UniProt

O00533

Expression Region

35-124

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcyphosine 2
308819 100 µL

Calcyphosine 2

Sign In for Pricing
View Details
CD48 Antibody (Pan Leukocyte Marker)
orb2635582 100 µg

CD48 Antibody (Pan Leukocyte Marker)

Sign In for Pricing
View Details
PEX3 (Peroxisomal Biogenesis Factor 3, Peroxin-3, Peroxisomal Assembly Protein PEX3, DKFZp686N14184, FLJ13531) (PE)
138215-PE 100 µL

PEX3 (Peroxisomal Biogenesis Factor 3, Peroxin-3, Peroxisomal Assembly Protein PEX3, DKFZp686N14184, FLJ13531) (PE)

Sign In for Pricing
View Details
STAT5a Recombinant Antibody, APC-Cy7 Conjugated
bsm-52237R-APC-Cy7 100 µL

STAT5a Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Goat Anti-Equine IgM Polyclonal Antibody
VD11N770 1 Each

Goat Anti-Equine IgM Polyclonal Antibody

Sign In for Pricing
View Details
Rat Noradrenaline, NE ELISA Kit
CK-bio-15078-01 48 Tests

Rat Noradrenaline, NE ELISA Kit

Sign In for Pricing
View Details