Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate-specific antigen (KLK3)

This Recombinant Human Prostate-specific antigen (KLK3) spans the amino acid sequence from region 25-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prostate-specific antigen; PSA; EC 3.4.21.77; Gamma-seminoprotein; Seminin; Kallikrein-3; P-30 antigen; Semenogelase; KLK3 APS

UniProt

P07288

Expression Region

25-261

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep PIR (Pirin) ELISA Kit
MBS2508578-01 24 Tests

Sheep PIR (Pirin) ELISA Kit

Sign In for Pricing
View Details
Sheep PIR (Pirin) ELISA Kit
MBS2508578-02 48 Tests

Sheep PIR (Pirin) ELISA Kit

Sign In for Pricing
View Details
Sheep PIR (Pirin) ELISA Kit
MBS2508578-03 96 Tests

Sheep PIR (Pirin) ELISA Kit

Sign In for Pricing
View Details
Sheep PIR (Pirin) ELISA Kit
MBS2508578-04 5x 96 Tests

Sheep PIR (Pirin) ELISA Kit

Sign In for Pricing
View Details
Sheep PIR (Pirin) ELISA Kit
MBS2508578-05 10x 96 Tests

Sheep PIR (Pirin) ELISA Kit

Sign In for Pricing
View Details
Anti-Human IFT43 Polyclonal Antibody
PHK96601 100 μg

Anti-Human IFT43 Polyclonal Antibody

Sign In for Pricing
View Details