Recombinant Human Immunoglobulin lambda constant 3 (IGLC3)
This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin lambda constant 3; Ig lambda chain C region DOT; Ig lambda chain C region NEWM; Ig lambda-3 chain C regions; IGLC3
UniProt
P0DOY3
Expression Region
1-106
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6236742-01 0.1 mL
TGF-alpha (EGF-like TGF, ETGF, TFGA, TGF Type 1, TGFA, Wa1, Waved 1) (BSA & Azide Free) (MaxLight 750)
Sign In for Pricing
View Details MBS6236742-02 5x 0.1 mL
TGF-alpha (EGF-like TGF, ETGF, TFGA, TGF Type 1, TGFA, Wa1, Waved 1) (BSA & Azide Free) (MaxLight 750)
Sign In for Pricing
View Details 
ELI-50619h 96 Tests
Human Transmembrane protein C20orf123, C20orf123 ELISA KIT
Sign In for Pricing
View Details