Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-5AC (MUC5A), partial

This Recombinant Human Mucin-5AC (MUC5A), partial spans the amino acid sequence from region 4919-5103. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mucin-5AC; MUC-5AC; Gastric mucin; Major airway glycoprotein; Mucin-5 subtype AC, tracheobronchial; Tracheobronchial mucin; TBM; MUC5AC MUC5

UniProt

P98088

Expression Region

4919-5103

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-2 R beta Antibody (5H4) [DyLight 550]
NBP3-12040R 0.1 mL

Rabbit Monoclonal IL-2 R beta Antibody (5H4) [DyLight 550]

Sign In for Pricing
View Details
FRAS1 Rabbit Polyclonal Antibody (PerCP)
orb2526826 100 µL

FRAS1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Lentiviral human G2E3 sgRNA gene knockout kit - Lentiviral human G2E3 sgRNA gene knockout kit (plasmid)
GTR15379247 1 Vial

Lentiviral human G2E3 sgRNA gene knockout kit - Lentiviral human G2E3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Anti-Mouse CD279/PDCD1/PD1 Recombinant Antibody (J43)
MS870043-01 50 µg

Anti-Mouse CD279/PDCD1/PD1 Recombinant Antibody (J43)

Sign In for Pricing
View Details
Anti-Mouse CD279/PDCD1/PD1 Recombinant Antibody (J43)
MS870043-02 100 µg

Anti-Mouse CD279/PDCD1/PD1 Recombinant Antibody (J43)

Sign In for Pricing
View Details
Anti-Mouse CD279/PDCD1/PD1 Recombinant Antibody (J43)
MS870043-03 1 mg

Anti-Mouse CD279/PDCD1/PD1 Recombinant Antibody (J43)

Sign In for Pricing
View Details