Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 85 (ZNF85)

This Recombinant Human Zinc finger protein 85 (ZNF85) spans the amino acid sequence from region 1-595. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 85; Zinc finger protein HPF4; Zinc finger protein HTF1; ZNF85

UniProt

Q03923

Expression Region

1-595

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTHKIIHTGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECEKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIHTGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CACNA2D3 activation kit by CRISPRa
GA110979 1 Kit

Human CACNA2D3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein
TP304243M 100 µg

Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein

Sign In for Pricing
View Details
Zmat2 Mouse Gene Knockout Kit (CRISPR)
KN520102 1 Kit

Zmat2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), 0.2mg/mL
BNUB0864-100 1x 100 µL

Glypican-3 (GPC3/863 + 1G12), 0.2mg/mL

Sign In for Pricing
View Details
Human FAPP2 (PLEKHA8) activation kit by CRISPRa
GA113675 1 Kit

Human FAPP2 (PLEKHA8) activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC24 Human qPCR Primer Pair (NM_152499)
HP217756 200 Reactions

CCDC24 Human qPCR Primer Pair (NM_152499)

Sign In for Pricing
View Details