Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-10 (LEG10)

This Recombinant Human Galectin-10 (LEG10) spans the amino acid sequence from region 2-142. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Galectin-10; Gal-10; Charcot-Leyden crystal protein; CLC; Eosinophil lysophospholipase; Lysolecithin acylhydrolase; CLC LGALS10 LGALS10A

UniProt

Q05315

Expression Region

2-142

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1B siRNA (Mouse)
MBS8220621-01 15 nmol

POLR1B siRNA (Mouse)

Sign In for Pricing
View Details
POLR1B siRNA (Mouse)
MBS8220621-02 30 nmol

POLR1B siRNA (Mouse)

Sign In for Pricing
View Details
POLR1B siRNA (Mouse)
MBS8220621-03 5x 30 nmol

POLR1B siRNA (Mouse)

Sign In for Pricing
View Details
Coronin 1a (CORO1A) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF501429 100 µg

Coronin 1a (CORO1A) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

Sign In for Pricing
View Details
Mouse A730090N16Rik activation kit by CRISPRa
GA216356 1 Kit

Mouse A730090N16Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal RPL39L Antibody [FITC]
NBP2-97619F 0.1 mL

Rabbit Polyclonal RPL39L Antibody [FITC]

Sign In for Pricing
View Details