Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)

This Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) spans the amino acid sequence from region 74-282. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement component 1 Q subcomponent-binding protein, mitochondrial; ASF/SF2-associated protein p32; Glycoprotein gC1qBP; C1qBP; Hyaluronan-binding protein 1; Mitochondrial matrix protein p32; gC1q-R protein; p33; SF2AP32; C1QBP GC1QBP HABP1 SF2P32

UniProt

Q07021

Expression Region

74-282

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD93 (NM_012072) Human Tagged ORF Clone Lentiviral Particle
RC206980L2V 200 µL

CD93 (NM_012072) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GALNT2 Antibody
OACA08184-50UL 50 µL

GALNT2 Antibody

Sign In for Pricing
View Details
Fetuin A Matched ELISA Antibody Pair Set, Mouse
MBS8118472-01 5 Plates

Fetuin A Matched ELISA Antibody Pair Set, Mouse

Sign In for Pricing
View Details
Fetuin A Matched ELISA Antibody Pair Set, Mouse
MBS8118472-02 15 Plates

Fetuin A Matched ELISA Antibody Pair Set, Mouse

Sign In for Pricing
View Details
Fetuin A Matched ELISA Antibody Pair Set, Mouse
MBS8118472-03 5x 15 Plates

Fetuin A Matched ELISA Antibody Pair Set, Mouse

Sign In for Pricing
View Details
Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband® Fluoro594 Conjugated
PB10068-Fluoro594 100 µg/Vial

Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details