Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG3, Human ads Antibody : PE
OASB01643-250UG 0.25 mg

Mouse IgG3, Human ads Antibody : PE

Sign In for Pricing
View Details
Hsa-miR-4430 miRNA Mimic
orb1877515-01 5 nmol

Hsa-miR-4430 miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4430 miRNA Mimic
orb1877515-02 10 nmol

Hsa-miR-4430 miRNA Mimic

Sign In for Pricing
View Details
Recombinant Bacillus licheniformis ATP synthase subunit beta (atpD)
MBS1380183-01 0.02 mg (E-Coli)

Recombinant Bacillus licheniformis ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Bacillus licheniformis ATP synthase subunit beta (atpD)
MBS1380183-02 0.02 mg (Yeast)

Recombinant Bacillus licheniformis ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Bacillus licheniformis ATP synthase subunit beta (atpD)
MBS1380183-03 0.1 mg (E-Coli)

Recombinant Bacillus licheniformis ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details