Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin-18 binding prorein (IL-18BP) ELISA Kit
orb1669052-01 48 Tests

Human Interleukin-18 binding prorein (IL-18BP) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-18 binding prorein (IL-18BP) ELISA Kit
orb1669052-02 96 Tests

Human Interleukin-18 binding prorein (IL-18BP) ELISA Kit

Sign In for Pricing
View Details
RGD1563431 3'UTR Luciferase Stable Cell Line
TU218764 1.0 mL

RGD1563431 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Hsa-miR-767-3p antagomir
HY-RI02414A-01 5 nmol

Hsa-miR-767-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-767-3p antagomir
HY-RI02414A-02 20 nmol

Hsa-miR-767-3p antagomir

Sign In for Pricing
View Details
CCR7 Recombinant Rabbit mAb, PerCP conjugated
orb2351314 100 µL

CCR7 Recombinant Rabbit mAb, PerCP conjugated

Sign In for Pricing
View Details