Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TRPV3 Rabbit Polyclonal Antibody (N-term)
E28PB1312 100 µL

Mouse TRPV3 Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
5-Nitro-2-furaldehyde
GK4297-25g 25 g

5-Nitro-2-furaldehyde

Sign In for Pricing
View Details
COX10 Double Nickase Plasmid (m2)
sc-427691-NIC-2 20 µg

COX10 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Calcineurin
301590 100 µL

Calcineurin

Sign In for Pricing
View Details
TRIT1 Rabbit Polyclonal Antibody (PerCP)
orb2493006 100 µL

TRIT1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Rabbit E3 ubiquitin-protein ligase Mdm2 ELISA Kit
MBS7276596-01 48 Well

Rabbit E3 ubiquitin-protein ligase Mdm2 ELISA Kit

Sign In for Pricing
View Details