Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC5 Antibody
orb417347-01 50 µg

ZIC5 Antibody

Sign In for Pricing
View Details
ZIC5 Antibody
orb417347-02 100 µg

ZIC5 Antibody

Sign In for Pricing
View Details
IFNA5 Human Over-expression Lysate
orb1365227 20 µg

IFNA5 Human Over-expression Lysate

Sign In for Pricing
View Details
ARAP1 (NM_001040118) Human Over-expression Lysate
LY421684 100 µg

ARAP1 (NM_001040118) Human Over-expression Lysate

Sign In for Pricing
View Details
glypican-6 Lentiviral Activation Particles (h)
sc-405359-LAC 200 µL

glypican-6 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
PLEKHA6 sgRNA CRISPR Lentivector set (Human)
K1665801 3x 1.0 µg

PLEKHA6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details