Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MCM6 Protein, N-His
YHG83001 100 μg

Recombinant Human MCM6 Protein, N-His

Sign In for Pricing
View Details
T2 ring for Nikon D SLR digital camera
EAE-5025 1 Each

T2 ring for Nikon D SLR digital camera

Sign In for Pricing
View Details
TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (FITC)
MBS6175590-01 0.1 mL

TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (FITC)

Sign In for Pricing
View Details
TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (FITC)
MBS6175590-02 5x 0.1 mL

TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (FITC)

Sign In for Pricing
View Details
SRD5A2 (3-oxo-5-alpha-steroid 4-dehydrogenase 2, 5 alpha-SR2, SR Type 2, Steroid 5-alpha-reductase 2, S5AR 2, Type II 5-alpha Reductase)
S6505-08Q 100 µg

SRD5A2 (3-oxo-5-alpha-steroid 4-dehydrogenase 2, 5 alpha-SR2, SR Type 2, Steroid 5-alpha-reductase 2, S5AR 2, Type II 5-alpha Reductase)

Sign In for Pricing
View Details
BPU-11
HY-119102-01 5 mg

BPU-11

Sign In for Pricing
View Details