Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLXIP, NT (MLXIP, BHLHE36, KIAA0867, MIR, MONDOA, MLX-interacting protein, Class E basic helix-loop-helix protein 36, Transcriptional activator MondoA) (APC) discontinued
038488-APC 200 µL

MLXIP, NT (MLXIP, BHLHE36, KIAA0867, MIR, MONDOA, MLX-interacting protein, Class E basic helix-loop-helix protein 36, Transcriptional activator MondoA) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Rat Replication Protein A1 (RPA1)
RPU57622-01 50 µg

Recombinant Rat Replication Protein A1 (RPA1)

Sign In for Pricing
View Details
Recombinant Rat Replication Protein A1 (RPA1)
RPU57622-02 100 µg

Recombinant Rat Replication Protein A1 (RPA1)

Sign In for Pricing
View Details
Recombinant Rat Replication Protein A1 (RPA1)
RPU57622-03 1 mg

Recombinant Rat Replication Protein A1 (RPA1)

Sign In for Pricing
View Details
Lentiviral human TBCB shRNA (UAS) - Lentiviral human TBCB shRNA (UAS, RFP) plasmid
GTR15325528 1 Vial

Lentiviral human TBCB shRNA (UAS) - Lentiviral human TBCB shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Substance P-Gly-Lys-Arg
MBS5818375 Inquire

Substance P-Gly-Lys-Arg

Sign In for Pricing
View Details