Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-14 (SNX14), partial

This Recombinant Human Sorting nexin-14 (SNX14), partial spans the amino acid sequence from region 130-304. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-14 SNX14

UniProt

Q9Y5W7

Expression Region

130-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLIRRIHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFIDDSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF568 conjugate, 0.1mg/mL
BNC682233-100 1x 100 µL

Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), 0.2mg/mL
BNUB1475-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF770 conjugate, 0.1mg/mL
BNC701841-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EHMT1/GLP (EHMT1) (NM_024757) Human Over-expression Lysate
LY403026 100 µg

EHMT1/GLP (EHMT1) (NM_024757) Human Over-expression Lysate

Sign In for Pricing
View Details
Phosphoglycolic Acid
TRC-P358200-5MG 5 mg

Phosphoglycolic Acid

Sign In for Pricing
View Details
WDR70 Human Gene Knockout Kit (CRISPR)
KN401712 1 Kit

WDR70 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details