Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 1-50 IGLV1-50

UniProt

A0A075B6I6

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heptakis (2,3,6-tri-O-ethyl) -β-cyclodextrin
orb2939440-01 100 mg

Heptakis (2,3,6-tri-O-ethyl) -β-cyclodextrin

Sign In for Pricing
View Details
Heptakis (2,3,6-tri-O-ethyl) -β-cyclodextrin
orb2939440-02 50 mg

Heptakis (2,3,6-tri-O-ethyl) -β-cyclodextrin

Sign In for Pricing
View Details
Heptakis (2,3,6-tri-O-ethyl) -β-cyclodextrin
orb2939440-03 250 mg

Heptakis (2,3,6-tri-O-ethyl) -β-cyclodextrin

Sign In for Pricing
View Details
SLC25A35 (HRP)
576667-01 50 µg

SLC25A35 (HRP)

Sign In for Pricing
View Details
SLC25A35 (HRP)
576667-02 100 µg

SLC25A35 (HRP)

Sign In for Pricing
View Details
CD7 Antibody Blocking Peptide
orb1515624 500 µg

CD7 Antibody Blocking Peptide

Sign In for Pricing
View Details