Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240)

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240) spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cartilage
CS701014 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
WDR33 Human Gene Knockout Kit (CRISPR)
KN416403 1 Kit

WDR33 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CCNB1IP1 activation kit by CRISPRa
GA111737 1 Kit

Human CCNB1IP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell Helper,  15nm
GM-06-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell Helper, 15nm

Sign In for Pricing
View Details
ATG12 Rabbit Polyclonal Antibody
ER1802-82 100 µL

ATG12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ropn1l Mouse Gene Knockout Kit (CRISPR)
KN514983 1 Kit

Ropn1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details