Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240)

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240) spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJA3 Antibody - C-terminal region : Biotin (ARP64449_P050-Biotin)
ARP64449_P050-Biotin 100 µL

DNAJA3 Antibody - C-terminal region : Biotin (ARP64449_P050-Biotin)

Sign In for Pricing
View Details
CD272 Antibody HRP Conjugated
MBS9459955-01 0.1 mL

CD272 Antibody HRP Conjugated

Sign In for Pricing
View Details
CD272 Antibody HRP Conjugated
MBS9459955-02 5x 0.1 mL

CD272 Antibody HRP Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal Stathmin 1 Antibody (STMN1/9227R) [DyLight 405]
NBP3-26964V 0.1 mL

Rabbit Monoclonal Stathmin 1 Antibody (STMN1/9227R) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Campylobacter curvus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1054003-01 0.02 mg (E-Coli)

Recombinant Campylobacter curvus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details
Recombinant Campylobacter curvus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1054003-02 0.02 mg (Yeast)

Recombinant Campylobacter curvus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details