Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal STK39 Antibody [Alexa Fluor 350]
NBP1-76957AF350 0.1 mL

Rabbit Polyclonal STK39 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
GTPBP10 CRISPR Activation Plasmid (h)
sc-413794-ACT 20 µg

GTPBP10 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Recombinant Brucella Ovis secB Protein (aa 1-163)
VAng-Lsx5532-50gEcoli 50 µg (E. coli)

Recombinant Brucella Ovis secB Protein (aa 1-163)

Sign In for Pricing
View Details
CALM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0355405 3x 1.0 µg

CALM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Pdik1l Mouse shRNA Plasmid (Locus ID 230809)
TR506896 1 Kit

Pdik1l Mouse shRNA Plasmid (Locus ID 230809)

Sign In for Pricing
View Details
GABRA4 Rabbit Polyclonal Antibody (RBITC)
orb1056222 100 µL

GABRA4 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details