Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit
MBS2021860-01 24 Strip Well

Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit
MBS2021860-02 48 Well

Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit
MBS2021860-03 96 Well

Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit
MBS2021860-04 5x 96 Well

Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit
MBS2021860-05 10x 96 Well

Rat Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Anti-SGK1 (pS422) Phospho Antibody
MBS8243005-01 0.03 mL

Anti-SGK1 (pS422) Phospho Antibody

Sign In for Pricing
View Details