Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-8 (TVB68)

This Recombinant Human T cell receptor beta variable 6-8 (TVB68) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-8 TRBV6-8

UniProt

A0A0A6YYG3

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYLCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS11 antibody
70R-33914 100 ug

RPS11 antibody

Sign In for Pricing
View Details
PCBP2 Rabbit Polyclonal Antibody (Biotin)
orb452111 100 µL

PCBP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DOLPP1 CRISPR/Cas9 KO Plasmid (m)
sc-425339 20 µg

DOLPP1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
B0001.4 Antibody
orb802804 2 mg

B0001.4 Antibody

Sign In for Pricing
View Details
TRNAQ44P-set siRNA/shRNA/RNAi Lentivector (Human)
48315091 4x 500 ng

TRNAQ44P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal EPDR1 Antibody [DyLight 680]
NBP3-00177FR 0.1 mL

Rabbit Polyclonal EPDR1 Antibody [DyLight 680]

Sign In for Pricing
View Details