Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321)

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFAP-110 (D-11) Alexa Fluor® 647
sc-374655 AF647 200 µg/mL

AFAP-110 (D-11) Alexa Fluor® 647

Sign In for Pricing
View Details
OLA1 siRNA (Rat)
CRR4462-01 15 nmol

OLA1 siRNA (Rat)

Sign In for Pricing
View Details
OLA1 siRNA (Rat)
CRR4462-02 30 nmol

OLA1 siRNA (Rat)

Sign In for Pricing
View Details
EVR3 Protein Vector (Human) (pPB-C-His)
PV076293 500 ng

EVR3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
TMEM184A Adenovirus (Rat)
46958056 1.0 mL

TMEM184A Adenovirus (Rat)

Sign In for Pricing
View Details
1- (5-Chloropyridin-2-yl) propan-1-one
OR1049581-01 100 mg

1- (5-Chloropyridin-2-yl) propan-1-one

Sign In for Pricing
View Details