Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Nucleocapsid Protein (His Tag)
PKSR030497 100 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein (His Tag)

Sign In for Pricing
View Details
Tmprss9 Mouse Gene Knockout Kit (CRISPR)
KN517946 1 Kit

Tmprss9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human PGK1/PGKA Protein (His Tag)
PKSH032892-01 10 µg

Recombinant Human PGK1/PGKA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PGK1/PGKA Protein (His Tag)
PKSH032892-02 50 µg

Recombinant Human PGK1/PGKA Protein (His Tag)

Sign In for Pricing
View Details
Concanavalin A, CF®350 Conjugate
#29015 5x 1 mg

Concanavalin A, CF®350 Conjugate

Sign In for Pricing
View Details
16a,17-Epoxy-11b-hydroxypregn-4-ene-3,20-dione
TRC-E589730-25MG 25 mg

16a,17-Epoxy-11b-hydroxypregn-4-ene-3,20-dione

Sign In for Pricing
View Details