Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A2 Blocking Peptide
33R-3097 0.1 mg

SLC6A2 Blocking Peptide

Sign In for Pricing
View Details
DGKZ Antibody
CSB-PA070072-01 50 µg

DGKZ Antibody

Sign In for Pricing
View Details
DGKZ Antibody
CSB-PA070072-02 100 µg

DGKZ Antibody

Sign In for Pricing
View Details
Mouse Pf4/ Platelet factor 4 ELISA Kit
orb2657191 96 Tests

Mouse Pf4/ Platelet factor 4 ELISA Kit

Sign In for Pricing
View Details
GENLISA Human Cytochrome-C (CYT-C) ELISA
KBH9752 1x 96 Well

GENLISA Human Cytochrome-C (CYT-C) ELISA

Sign In for Pricing
View Details
Human Polymorphonuclear Elastase (PMN Elastase) ELISA Kit
MBS3800523-01 48 Well

Human Polymorphonuclear Elastase (PMN Elastase) ELISA Kit

Sign In for Pricing
View Details