Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 1 Antitrypsin (SERPINA1) (NM_001127702) Human Recombinant Protein
TP325657 20 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127702) Human Recombinant Protein

Sign In for Pricing
View Details
Zfp352 Rabbit Polyclonal Antibody
ER2001-55 100 µL

Zfp352 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ARH3 (ADPRHL2) activation kit by CRISPRa
GA110385 1 Kit

Human ARH3 (ADPRHL2) activation kit by CRISPRa

Sign In for Pricing
View Details
IL-10Rα (Ab-496) Antibody
8B1056-AAT 50 µg

IL-10Rα (Ab-496) Antibody

Sign In for Pricing
View Details
Bromocyclopropane-d5
TRC-B682763-500MG 500 mg

Bromocyclopropane-d5

Sign In for Pricing
View Details
Recombinant Human GSK3B Protein (His Tag)
PKSH030425 50 µg

Recombinant Human GSK3B Protein (His Tag)

Sign In for Pricing
View Details