Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vacuolar-sorting protein SNF8 (SNF8) Rat ELISA Kit
I1901 96 Tests

Vacuolar-sorting protein SNF8 (SNF8) Rat ELISA Kit

Sign In for Pricing
View Details
MrpL39 Polyclonal Antibody, RBITC Conjugated
bs-3835R-RBITC 100 µL

MrpL39 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
BTLA Recombinant Protein Fc Tag Lyophilized 100UG
IMSBTLARFCLY100UG 100 µg

BTLA Recombinant Protein Fc Tag Lyophilized 100UG

Sign In for Pricing
View Details
MYP14 CRISPR Knock Out 293T Cell Line (Human)
31322141 1x 10^6 Cells / 1.0 mL

MYP14 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Formin-like protein 1 Antibody (Biotin)
orb3168173 100 µg

Formin-like protein 1 Antibody (Biotin)

Sign In for Pricing
View Details
AdSS2 CRISPR Activation Plasmid (m2)
sc-419031-ACT-2 20 µg

AdSS2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details