Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56)

This Recombinant Human T cell receptor beta variable 5-6 (TVB56) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Simian immunodeficiency virus agm.vervet Envelope glycoprotein gp160 (env), partial
MBS1171838 Inquire

Recombinant Simian immunodeficiency virus agm.vervet Envelope glycoprotein gp160 (env), partial

Sign In for Pricing
View Details
Human ADP-Ribosylation Factor 1 (ARF1)
B2015523 10 µg

Human ADP-Ribosylation Factor 1 (ARF1)

Sign In for Pricing
View Details
(2S,3R,5S)-Omarigliptin-d3
TRC-O633137-25MG 25 mg

(2S,3R,5S)-Omarigliptin-d3

Sign In for Pricing
View Details
ZNF284 Human siRNA Oligo Duplex (Locus ID 342909)
SR317570 1 Kit

ZNF284 Human siRNA Oligo Duplex (Locus ID 342909)

Sign In for Pricing
View Details
Bovine anti Chlamydia trachomatis, CT antibody IgG ELISA Kit
GTR10363427 96 Well

Bovine anti Chlamydia trachomatis, CT antibody IgG ELISA Kit

Sign In for Pricing
View Details
C-jun Monoclonal Antibody, AbBy Fluor™ 405 Conjugated
bsm-42049M-BF405 100 µL

C-jun Monoclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details