Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein PTGES3L (PTG3L)

This Recombinant Human Putative protein PTGES3L (PTG3L) spans the amino acid sequence from region 1-166. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein PTGES3L; Prostaglandin E synthase 3-like; PTGES3L

UniProt

E9PB15

Expression Region

1-166

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDDDSDSADDATSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromo Polystyrene
H50056009.100G 100 g

Bromo Polystyrene

Sign In for Pricing
View Details
Beta-Zeranol
TRC-Z346005-1MG 1 mg

Beta-Zeranol

Sign In for Pricing
View Details
Human MATH5 (ATOH7) activation kit by CRISPRa
GA116567 1 Kit

Human MATH5 (ATOH7) activation kit by CRISPRa

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), 1mg/mL
BNUM3102-50 1x 50 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), 1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS716816 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
GST3 (GSTP1) (C-term) Rabbit Polyclonal Antibody
AP23405PU-N 100 µg

GST3 (GSTP1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details