Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein PTGES3L (PTG3L)

This Recombinant Human Putative protein PTGES3L (PTG3L) spans the amino acid sequence from region 1-166. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein PTGES3L; Prostaglandin E synthase 3-like; PTGES3L

UniProt

E9PB15

Expression Region

1-166

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDDDSDSADDATSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat EAAT2 (Excitatory Amino Acid Transporter 2) ELISA Kit
ER21503 96 Tests

Rat EAAT2 (Excitatory Amino Acid Transporter 2) ELISA Kit

Sign In for Pricing
View Details
CNN2 (Calponin-2, Calponin H2, Smooth Muscle, Neutral Calponin, Calponin 2) (FITC)
125130-FITC 100 µL

CNN2 (Calponin-2, Calponin H2, Smooth Muscle, Neutral Calponin, Calponin 2) (FITC)

Sign In for Pricing
View Details
Human Transmembrane Protein 98 (TMEM98) ELISA Kit
MBS9713930-01 48 Tests

Human Transmembrane Protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protein 98 (TMEM98) ELISA Kit
MBS9713930-02 96 Tests

Human Transmembrane Protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protein 98 (TMEM98) ELISA Kit
MBS9713930-03 5x 96 Tests

Human Transmembrane Protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal S100A5 Antibody (S100A5/7475) [mFluor Violet 450 SE]
NBP3-24012MFV450 0.1 mL

Mouse Monoclonal S100A5 Antibody (S100A5/7475) [mFluor Violet 450 SE]

Sign In for Pricing
View Details