Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARTS1 (ERAP1) (NM_016442) Human Over-expression Lysate
LC402550 20 µg

ARTS1 (ERAP1) (NM_016442) Human Over-expression Lysate

Sign In for Pricing
View Details
Jag2 Mouse Gene Knockout Kit (CRISPR)
KN308538BN 1 Kit

Jag2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRITC–dextran conjugate (average MW = ~150K)
21710-AAT 25 mg

TRITC–dextran conjugate (average MW = ~150K)

Sign In for Pricing
View Details
2-Chloroanthracene
TRC-C364390-100MG 100 mg

2-Chloroanthracene

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF488A conjugate, 0.1mg/mL
BNC882894-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dehydroepiandrosterone 3beta-Glucuronide
TRC-D143175-5MG 5 mg

Dehydroepiandrosterone 3beta-Glucuronide

Sign In for Pricing
View Details